DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and PH1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_565687.1 Gene:PH1 / 817520 AraportID:AT2G29700 Length:145 Species:Arabidopsis thaliana


Alignment Length:150 Identity:41/150 - (27%)
Similarity:73/150 - (48%) Gaps:31/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   565 LESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTT 629
            :||::   |....:.|..:..:.:..:.||::.|||.|||...|:|:||||:|....|.:|:...
plant     1 MESIW---RIATGQDPSREDYEGIEFWSNPERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFKDQA 62

  Fly   630 -----DKEPRGIIPL-ENISVREIHD-RSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYR 687
                 ...|||:|.: :.::|:...| .:||..|||.:                    |.:|:: 
plant    63 AAGIRGSTPRGVISVGDCLTVKGAEDVVNKPFAFELSS--------------------GSYTMF- 106

  Fly   688 MSAATEEDQQEWIKRLTQSI 707
            ..|..|::::|||..:.:||
plant   107 FIADNEKEKEEWINSIGRSI 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 3/11 (27%)
PH_GRP1-like 592..710 CDD:269954 36/122 (30%)
PH 596..708 CDD:278594 34/118 (29%)
PH1NP_565687.1 PH_AtPH1 29..136 CDD:270095 34/118 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.