DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and cyth3

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001072881.1 Gene:cyth3 / 780343 XenbaseID:XB-GENE-941327 Length:394 Species:Xenopus tropicalis


Alignment Length:383 Identity:250/383 - (65%)
Similarity:315/383 - (82%) Gaps:8/383 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 INTEQSDNLVILRRPSKQIKD-------ELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMD 409
            ::.|:.:.|:.:||..|::.|       |:.||::|::.|...|:.|.:.::||:::||||||||
 Frog    11 LSPEEREELLNIRRRKKELIDDIERLKFEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMD 75

  Fly   410 PKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLIL 474
            |||||::|:||.||::.|:|:|.|||||||||||.|||||||::|||..||:|||.||:|.:|.|
 Frog    76 PKKGIQFLIENDLLQNTPEDIAQFLYKGEGLNKTVIGDYLGERDDFNIHVLQAFVELHEFADLNL 140

  Fly   475 VQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVK 539
            |||||||||||||||||||||||||.||.|||..||.:|.:|||||||||||||||||||||:|:
 Frog   141 VQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVR 205

  Fly   540 DKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQG 604
            |||:|::|||||||||.|||||..||.:|||||:.||||||:||||||.|||||||:||||.|.|
 Frog   206 DKPSVERFISMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLG 270

  Fly   605 GRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELF-ATGGADIIK 668
            ||.|:||||||||.|||||||||||||||||||||||:|:||:.|..||:||||: .:....:||
 Frog   271 GRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIK 335

  Fly   669 ACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHNPFYDILVQRKKKALSK 726
            ||||:::|:||||.|.|||:||.|.|:::||||.:..|||.:||||:|..||::..:|
 Frog   336 ACKTEADGRVVEGNHVVYRISAPTPEEKEEWIKSIKASISRDPFYDMLATRKRRIANK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 135/179 (75%)
PH_GRP1-like 592..710 CDD:269954 80/118 (68%)
PH 596..708 CDD:278594 74/112 (66%)
cyth3NP_001072881.1 Sec7 61..243 CDD:366596 135/181 (75%)
PH_GRP1-like 258..377 CDD:269954 80/118 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 291 1.000 Domainoid score I1511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 534 1.000 Inparanoid score I1179
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000619
OrthoInspector 1 1.000 - - otm49115
Panther 1 1.100 - - LDO PTHR10663
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5313
SonicParanoid 1 1.000 - - X419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.180

Return to query results.
Submit another query.