DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Plekha4

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_006541221.1 Gene:Plekha4 / 69217 MGIID:1916467 Length:831 Species:Mus musculus


Alignment Length:188 Identity:43/188 - (22%)
Similarity:66/188 - (35%) Gaps:74/188 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 TSLHNPSVKDKPT-----VDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHT 590
            :||.:.|.| |||     |..|...|..:....:||                          :|.
Mouse    72 SSLSSLSTK-KPTRAVHKVHAFGKRNNALRRDPNLP--------------------------VHI 109

  Fly   591 FFNPDKEGWLWKQ-GGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPH 654
                  .|||.|| ....:.||||||:|:.:||:|::.:.::...|.:.|.:.|||         
Mouse   110 ------RGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYSVR--------- 159

  Fly   655 CFELFATGGADIIKACKTDSEGKVVEGKHT---------VYRMSAATEEDQQEWIKRL 703
                             .|..|.....:.|         .|.::|.|.||.:.|::.|
Mouse   160 -----------------PDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRAL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 12/50 (24%)
PH_GRP1-like 592..710 CDD:269954 30/122 (25%)
PH 596..708 CDD:278594 30/118 (25%)
Plekha4XP_006541221.1 PH_PEPP1_2_3 101..204 CDD:270068 33/158 (21%)
PHA03247 <276..812 CDD:223021
Smc <411..>523 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.