DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and fbxo8

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001035397.1 Gene:fbxo8 / 678549 ZFINID:ZDB-GENE-060421-7091 Length:323 Species:Danio rerio


Alignment Length:181 Identity:54/181 - (29%)
Similarity:94/181 - (51%) Gaps:13/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 QMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKA 462
            ::..|...||.:|::||.|.:...:|...|:::|.|::....||...:..||.|:    .|||..
Zfish   142 ELDEGSLTFNANPQEGISYFMSRGILVEHPKEIAKFIFYTRMLNWKMLRIYLDER----RDVLDE 202

  Fly   463 FVALHDFTNLILVQALRQFLWSFRLPGE-AQKIDRMMETFAQRYCQLNP----DIFTNTDTCYVL 522
            .|.||:|:|..|..|||.|......|.| .:.::.::..|:.|:|..||    ::..:.|..|||
Zfish   203 LVTLHNFSNQFLPNALRDFFRHIHAPEERGEYLETLITKFSHRFCACNPALVQEVGLSPDAVYVL 267

  Fly   523 SFAIIMLNTSLHNPSVKDKPTVDQFI-SMNRGINNGGDLPRGLLESLYESI 572
            .:::|:|:..|.:|.||:|.:..:|| :..|...|   :....:..||::|
Zfish   268 CYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQN---ISEDFVGHLYDNI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 54/181 (30%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
fbxo8NP_001035397.1 F-box-like 78..116 CDD:315592
Sec7 141..316 CDD:238100 54/181 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.