DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Mon2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_011241835.1 Gene:Mon2 / 67074 MGIID:1914324 Length:1716 Species:Mus musculus


Alignment Length:81 Identity:23/81 - (28%)
Similarity:36/81 - (44%) Gaps:16/81 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 VSRPVELLL-NENGEIIARRSPRKSRSNSLGRMLD--------VQNEIGTGGLFMEA----DPCS 283
            ||.||.:|| |.:|..::|..   .|::|:|..|.        |.:|:....|:..|    ....
Mouse  1189 VSVPVPVLLGNLSGPGLSRPF---VRTDSIGEKLGRCGSETPVVTDELEDLKLWWAAWNTWHRTG 1250

  Fly   284 KNSLPPPPYIDDMRFI 299
            ..|..||..:|::.||
Mouse  1251 SESTEPPSSVDELTFI 1266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
Mon2XP_011241835.1 DCB 9..180 CDD:374438
Sec7_N 211..378 CDD:372313
DUF1981 <871..930 CDD:370432
Mon2_C 933..1707 CDD:374431 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.