Sequence 1: | NP_001036375.2 | Gene: | step / 35425 | FlyBaseID: | FBgn0086779 | Length: | 727 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067636.1 | Gene: | PLEKHA2 / 59339 | HGNCID: | 14336 | Length: | 425 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 59/235 - (25%) |
---|---|---|---|
Similarity: | 92/235 - (39%) | Gaps: | 66/235 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 536 PSVKDKPTVDQFISMNRGI-------NNGGDLPRGLLESLYESIRTEPFKIP-----QDDGNDLM 588
Fly 589 HTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKP 653
Fly 654 HCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL--------------- 703
Fly 704 -----------TQSISHNPFYDILVQ-----RKKKALSKS 727 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
step | NP_001036375.2 | Sec7 | 397..577 | CDD:279680 | 11/47 (23%) |
PH_GRP1-like | 592..710 | CDD:269954 | 36/143 (25%) | ||
PH | 596..708 | CDD:278594 | 35/137 (26%) | ||
PLEKHA2 | NP_067636.1 | PH1_TAPP1_2 | 1..119 | CDD:270089 | |
PH | 10..113 | CDD:278594 | |||
PH2_TAPP1_2 | 192..307 | CDD:270090 | 36/136 (26%) | ||
PH | 199..297 | CDD:278594 | 35/119 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 312..332 | 4/20 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 352..425 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |