DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and PLEKHA2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_067636.1 Gene:PLEKHA2 / 59339 HGNCID:14336 Length:425 Species:Homo sapiens


Alignment Length:235 Identity:59/235 - (25%)
Similarity:92/235 - (39%) Gaps:66/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 PSVKDKPTVDQFISMNRGI-------NNGGDLPRGLLESLYESIRTEPFKIP-----QDDGNDLM 588
            |:::.||.|.....:..|:       .||||...|.....:..:|.....||     ...|..|:
Human   136 PALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLI 200

  Fly   589 HTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKP 653
                   |.|:..|||...||||||:|.|:|..:.||:...|:|     ||..|.::::   .|.
Human   201 -------KSGYCVKQGNVRKSWKRRFFALDDFTICYFKCEQDRE-----PLRTIFLKDV---LKT 250

  Fly   654 HCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL--------------- 703
            |  |.....|..:::    |:..:::....|.| :.|.:.||...|||.:               
Human   251 H--ECLVKSGDLLMR----DNLFEIITSSRTFY-VQADSPEDMHSWIKEIGAAVQALKCHPRETS 308

  Fly   704 -----------TQSISHNPFYDILVQ-----RKKKALSKS 727
                       :.|:|..| ..||.:     .:||||.|:
Human   309 FSRSISLTRPGSSSLSSGP-NSILCRGRPPLEEKKALCKA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 11/47 (23%)
PH_GRP1-like 592..710 CDD:269954 36/143 (25%)
PH 596..708 CDD:278594 35/137 (26%)
PLEKHA2NP_067636.1 PH1_TAPP1_2 1..119 CDD:270089
PH 10..113 CDD:278594
PH2_TAPP1_2 192..307 CDD:270090 36/136 (26%)
PH 199..297 CDD:278594 35/119 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..332 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.