| Sequence 1: | NP_001036375.2 | Gene: | step / 35425 | FlyBaseID: | FBgn0086779 | Length: | 727 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002882.3 | Gene: | RASGRF1 / 5923 | HGNCID: | 9875 | Length: | 1273 | Species: | Homo sapiens |
| Alignment Length: | 236 | Identity: | 51/236 - (21%) |
|---|---|---|---|
| Similarity: | 80/236 - (33%) | Gaps: | 85/236 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 550 MNRGI--NNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKR 612
Fly 613 RWFILNDNCLYYFEYTTDKEPRGIIPLEN------------ISVRE------------IHDRSK- 652
Fly 653 --------PHCFELFATGGADIIKACKTDSEG---------KVVEGKHTVYRMSAATEEDQQEWI 700
Fly 701 KRL----------------TQSISHNPFYDILVQRKKKALS 725 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| step | NP_001036375.2 | Sec7 | 397..577 | CDD:279680 | 8/28 (29%) |
| PH_GRP1-like | 592..710 | CDD:269954 | 36/175 (21%) | ||
| PH | 596..708 | CDD:278594 | 36/169 (21%) | ||
| RASGRF1 | NP_002882.3 | PH | 489..583 | CDD:278594 | |
| RasGEF_N | 647..>695 | CDD:279012 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 724..754 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 809..874 | ||||
| REM | <938..1007 | CDD:295342 | |||
| RasGEF | 1034..1270 | CDD:214539 | |||
| PH_RasGRF1_2 | 19..154 | CDD:270081 | 29/144 (20%) | ||
| PH | 24..129 | CDD:278594 | 23/114 (20%) | ||
| RhoGEF | 244..425 | CDD:214619 | |||
| PH-like | 431..582 | CDD:302622 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||