DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and RASA2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_016862457.1 Gene:RASA2 / 5922 HGNCID:9872 Length:872 Species:Homo sapiens


Alignment Length:425 Identity:84/425 - (19%)
Similarity:158/425 - (37%) Gaps:128/425 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 NNNNDSKRE---SQQSNLCESCRMLLDRNYINTEQSDNLVILRRPSKQIKDELCEVVSEMEALDV 386
            |.|..||.:   |.:.|:|.:...:|...|....::   ::|:.|..|       .:|...|..:
Human   318 NGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKT---LLLKSPDVQ-------PISASAAYIL 372

  Fly   387 PEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGL--------NKT 443
            .|.|:..| |..:.:.|...:.|........|....|: |.|| |:.:::|..|        .|.
Human   373 SEICRDKN-DAVLPLVRLLLHHDKLVPFATAVAELDLK-DTQD-ANTIFRGNSLATRCLDEMMKI 434

  Fly   444 AIGDYL---------------------------GEKNDFNEDVLKAFVALHD--FTNLI------ 473
            ..|.||                           |:..:.|::.|:.:|   |  |..::      
Human   435 VGGHYLKVTLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYV---DKLFNTIVKSSMSC 496

  Fly   474 ------LVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTS 532
                  :..:||| :.:.|.|.:..          .:|..::..:|       :..||:.:::..
Human   497 PTVMCDIFYSLRQ-MATQRFPNDPH----------VQYSAVSSFVF-------LRFFAVAVVSPH 543

  Fly   533 L-----HNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDG-------- 584
            .     |:|..:...|:.......:.:.:.|.|.:. ..|..|:...|.||:.|::|        
Human   544 TFHLRPHHPDAQTIRTLTLISKTIQTLGSWGSLSKS-KSSFKETFMCEFFKMFQEEGYIIAVKKF 607

  Fly   585 ---------------NDLMHTFFNPDKEGWLWKQG-GR----YKSWKRRWFILNDNCLYYFEYTT 629
                           ::.:|.     |||.::|:. ||    .|::|:|||.|....|.|.:...
Human   608 LDEISSTETKESSGTSEPVHL-----KEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPG 667

  Fly   630 DKEPRGIIPLENI-SVREIHDRS--KPHCFELFAT 661
            .|:....||::|| :|.::.:.|  |.:.|::..|
Human   668 SKDAIYTIPVKNILAVEKLEESSFNKKNMFQVIHT 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 37/233 (16%)
PH_GRP1-like 592..710 CDD:269954 24/78 (31%)
PH 596..708 CDD:278594 24/74 (32%)
RASA2XP_016862457.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.