DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and PTPN11

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001317366.1 Gene:PTPN11 / 5781 HGNCID:9644 Length:597 Species:Homo sapiens


Alignment Length:425 Identity:81/425 - (19%)
Similarity:142/425 - (33%) Gaps:133/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PASPTLSTQTVN----CSDVTTKVTEV----QRLPCDEPNTELISKRTE----YKHTTITTTTRT 229
            |....||.:|.:    .:|..:|||.|    |.|..|....|.....|:    ||...:..|..|
Human   144 PGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGT 208

  Fly   230 LI-VSRPVELLLNENGEIIARRSPRKSRSNSLGRMLDVQNEIGTGGLF------MEADPCS---- 283
            :: :.:|:........||       :||...|.::.:..:::..|  |      ::...|.    
Human   209 VLQLKQPLNTTRINAAEI-------ESRVRELSKLAETTDKVKQG--FWEEFETLQQQECKLLYS 264

  Fly   284 ---------------KNSLPPPPYIDDMRFI--DDSSNSQSESERNSNIHKTNKYTSKNNNNDSK 331
                           ||.||    .|..|.:  |...|.......|:||... ::.:|.||:..|
Human   265 RKEGQRQENKNKNRYKNILP----FDHTRVVLHDGDPNEPVSDYINANIIMP-EFETKCNNSKPK 324

  Fly   332 RE------SQQSNLCESCRMLLDRN----YINTEQSDNLVILRRPSKQIK---DELC-EVVSEME 382
            :.      ..|:.:.:..||:...|    .:.|::     :.|..||.:|   ||.. :....|.
Human   325 KSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKE-----VERGKSKCVKYWPDEYALKEYGVMR 384

  Fly   383 ALDVPEDCKHSNKDKQMSIGR----------------KKFNMDPKKGIEYLVENRLLRHDPQDVA 431
            ..:|.|...|....:::.:.:                ..|...|..|:.         .||..|.
Human   385 VRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVWQYHFRTWPDHGVP---------SDPGGVL 440

  Fly   432 HFL----YKGE--------------GLNKTA-------IGDYLGEKN-DFNEDVLKAF-VALHDF 469
            .||    :|.|              |:.:|.       :.|.:.||. |.:.||.|.. :.....
Human   441 DFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQR 505

  Fly   470 TNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQR 504
            :.::..:|..:|::        ..:...:||..:|
Human   506 SGMVQTEAQYRFIY--------MAVQHYIETLQRR 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 24/151 (16%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
PTPN11NP_001317366.1 SH2_N-SH2_SHP_like 5..103 CDD:198203
SH2_C-SH2_SHP_like 111..218 CDD:198185 19/73 (26%)
PTPc-N11 272..528 CDD:350453 51/282 (18%)
Substrate binding. /evidence=ECO:0000250 463..469 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 552..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.