DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and kmr

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster


Alignment Length:174 Identity:39/174 - (22%)
Similarity:62/174 - (35%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 SVKDKPTVDQFISMNRGINNGGDLP------RGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPD 595
            :||.|.|.....|.:....:....|      .|.:::|...|...|...|             ..
  Fly   322 AVKPKATPSSEESSSNSTKSPSHAPLDRKKSAGSIQALKSPITKRPPSTP-------------VT 373

  Fly   596 KEGWLWKQGG-RYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELF 659
            ..|||.|||. ..|.|::|||:|.:.||||::...:::..|.:.|.:..|.......|  .:..|
  Fly   374 LSGWLHKQGSDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSVLLPSYRVSACLPEDK--IYRKF 436

  Fly   660 ATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL 703
            |.               |........|.::|...|...:|::.|
  Fly   437 AF---------------KCEHQNMRTYWLAADNSEAMMQWVRAL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 9/45 (20%)
PH_GRP1-like 592..710 CDD:269954 28/113 (25%)
PH 596..708 CDD:278594 28/109 (26%)
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 30/130 (23%)
PH 372..469 CDD:278594 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.