DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment step and plekha6

DIOPT Version :9

Sequence 1:	NP_001036375.2	Gene:	step / 35425	FlyBaseID:	FBgn0086779	Length:	727	Species:	Drosophila melanogaster
Sequence 2:	XP_021335504.1	Gene:	plekha6 / 568764	ZFINID:	ZDB-GENE-140106-14	Length:	1230	Species:	Danio rerio

Alignment Length:	140	Identity:	34/140 - (24%)
Similarity:	67/140 - (47%)	Gaps:	37/140 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   593 NPD----KEGWLWKQGGR-YKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDR-- 650
            ||:    ::|||:||... .|.|.:|||:|.|.||:|::...::...|.:||.:..:..:...
Zfish   131 NPNAEVSRQGWLYKQASSGVKQWNKRWFVLTDRCLFYYKDEKEEGVLGSLPLLSFKIGPVQTSDS 195

  Fly   651 -SKPHCFELFATGGADIIKACKTDSEGKVVE------------------GKHTVYRMSAATEEDQ 696
             ::...|:::          |:|:.|.:..|                  |..|.| .||.::::|
Zfish   196 ITRKFAFKVW----------CETEEEEEEEEESEDLKGSIAFCLQVEHAGTRTYY-FSADSQKEQ 249

  Fly   697 QEWIKRLTQS 706
            :|||:.::::
Zfish   250 EEWIQAMSEA 259

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
step	NP_001036375.2	Sec7	397..577	CDD:279680
		PH_GRP1-like	592..710	CDD:269954	34/140 (24%)
		PH	596..708	CDD:278594	32/133 (24%)
plekha6	XP_021335504.1	PH_PEPP1_2_3	130..260	CDD:270068	34/140 (24%)
plekha6	XP_021335504.1	SMC_N	<622..>775	CDD:330553
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910