DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment step and plek2

DIOPT Version :9

Sequence 1:	NP_001036375.2	Gene:	step / 35425	FlyBaseID:	FBgn0086779	Length:	727	Species:	Drosophila melanogaster
Sequence 2:	NP_001122211.1	Gene:	plek2 / 567753	ZFINID:	ZDB-GENE-080219-2	Length:	361	Species:	Danio rerio

Alignment Length:	114	Identity:	31/114 - (27%)
Similarity:	50/114 - (43%)	Gaps:	20/114 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   596 KEGWLWKQGGRYKSWKRRWFIL--NDNCLYYFEYTTDK-EPRGIIPLENISVREIHDRSKPHCFE 657
            |.|:|.|||.:.|:||.|.|:|  ....|:|::.:.|. .|.|.:.|....|..:.|...|
Zfish   258 KRGYLLKQGHKVKNWKVRLFVLRAEPGFLHYYDPSKDDVTPAGSVSLRGCLVSALDDNGTP---- 318

  Fly   658 LFATGGADIIKACKTDSEG---KVVEGKHTVYRMSAATEEDQQEWIKRL 703
                      ...|...:|   |::....|.|.:.|.|.|::.:||:.:
Zfish   319 ----------AGVKGKVQGNLFKIITQMDTHYYIQAPTHEERMDWIQAI 357

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
step	NP_001036375.2	Sec7	397..577	CDD:279680
		PH_GRP1-like	592..710	CDD:269954	31/114 (27%)
		PH	596..708	CDD:278594	31/114 (27%)
plek2	NP_001122211.1	PH1_Pleckstrin_2	8..118	CDD:270113
		PH	10..108	CDD:278594
		DEP_PLEK2	136..244	CDD:239891
		PH2_Pleckstrin_2	250..361	CDD:270114	31/114 (27%)
		PH	256..360	CDD:278594	31/114 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910