DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and osbp2b

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_021331891.1 Gene:osbp2b / 561797 ZFINID:ZDB-GENE-060526-3 Length:822 Species:Danio rerio


Alignment Length:111 Identity:32/111 - (28%)
Similarity:45/111 - (40%) Gaps:31/111 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 EGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEP----RGIIPLENISVREIHDRSKPHCFE 657
            :|||:|.....|.::||||:|::..|.|  |.|..|.    ||.|.|                  
Zfish    74 KGWLFKWTNYIKGYQRRWFVLSNGLLSY--YRTQAEMAHTCRGTINL------------------ 118

  Fly   658 LFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL 703
              ||...|...||..     |:......|.:.|:||.::|.|:..|
Zfish   119 --ATAHIDTEDACNI-----VLSSGGRTYHLKASTEVERQRWVTAL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954 32/111 (29%)
PH 596..708 CDD:278594 32/111 (29%)
osbp2bXP_021331891.1 PH_OSBP_ORP4 73..168 CDD:270101 32/111 (29%)
Oxysterol_BP 432..802 CDD:307410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.