DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and ADAP2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_024306599.1 Gene:ADAP2 / 55803 HGNCID:16487 Length:403 Species:Homo sapiens


Alignment Length:154 Identity:33/154 - (21%)
Similarity:60/154 - (38%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 DKEGWLWKQGGRYKSWKRRWFIL--NDNCLYYFEYTTDKEPRGIIPLENISVR------------ 645
            ::||:|||:|.....:.||.|:|  .:..|.||.....|.|:.:|.:::::..            
Human   134 NREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISIKDLNATFQTEKIGHPHGL 198

  Fly   646 EIHDRSKPHCFELFA--TGGADII------KACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKR 702
            :|..|...|...||.  ..|.:|:      :|.:..            |...|..|..:.|.:..
Human   199 QITYRRDGHTRNLFVYHESGKEIVDWFNALRAARLQ------------YLKMAFPELPESELVPF 251

  Fly   703 LTQSISHNPFYDILVQRKKKALSK 726
            ||::.....|.:....::|:...|
Human   252 LTRNYLKQGFMEKTGPKQKEPFKK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954 30/136 (22%)
PH 596..708 CDD:278594 30/133 (23%)
ADAP2XP_024306599.1 ArfGap 8..126 CDD:307528
PH1_ADAP 133..241 CDD:270072 26/118 (22%)
PH2_ADAP 255..362 CDD:241282 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.