DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and plekha1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001016833.1 Gene:plekha1 / 549587 XenbaseID:XB-GENE-1016597 Length:391 Species:Xenopus tropicalis


Alignment Length:354 Identity:72/354 - (20%)
Similarity:130/354 - (36%) Gaps:101/354 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 LDVPEDCKHSNKDKQMSIGRKKFNMDPKK-GIEYLVENRLLRHDPQDV----------------- 430
            ||:.|   |.|..|.:   |:.|.:|..: .:.:.::|      ||::                 
 Frog    14 LDIEE---HENSGKFL---RRYFILDTSQDSLLWYMDN------PQNLPAGSPCVGCLKLTYISK 66

  Fly   431 ----------AHFLY-KGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWS 484
                      |.|.: ...|:.|     |..:.|| .:|:::....|:..|.:.:.:       |
 Frog    67 VSDATKLRPKAEFCFVVNAGMRK-----YFLQAND-QQDLVEWINVLNKATKITVPK-------S 118

  Fly   485 FRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFIS 549
            :..||.|..::...:...::......||        |....||             .||..:...
 Frog   119 YDSPGLADSLNNQTDGGTKKQISYRTDI--------VGGVPII-------------TPTQQELSE 162

  Fly   550 MNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRW 614
                ..|.||  ||.|:.....:...|.:          |:..:..|.|:..|||...|:||||:
 Frog   163 ----CANTGD--RGNLKRTQSQLPCSPSR----------HSENSVIKAGYCVKQGAVMKNWKRRY 211

  Fly   615 FILNDNCLYYFEYTTDKEPRGIIPLENI----SVREIHDRSKPHCFELFATGGADIIKACKTD-- 673
            |:|::|.:.||:...:::|..:|.|..:    ..::..:..:.:.||:..|.....::|...|  
 Frog   212 FVLDENTIGYFKSEMERDPLRLIQLREVQKVQECKQSDNMLRDNLFEIVTTSRTFFVQADSPDEM 276

  Fly   674 -SEGKVVEGKHTVYR---MSAATEEDQQE 698
             |..:.:.|.....|   .|||:|....|
 Frog   277 HSWIRAISGAIVAQRGPARSAASEAPNSE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 34/208 (16%)
PH_GRP1-like 592..710 CDD:269954 31/117 (26%)
PH 596..708 CDD:278594 31/113 (27%)
plekha1NP_001016833.1 PH1_TAPP1_2 1..118 CDD:270089 22/128 (17%)
PH2_TAPP1_2 185..297 CDD:270090 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.