DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Skap2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_061243.1 Gene:Skap2 / 54353 MGIID:1889206 Length:358 Species:Mus musculus


Alignment Length:295 Identity:58/295 - (19%)
Similarity:104/295 - (35%) Gaps:112/295 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 PQDVAHFL----------YKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQF 481
            |:::.:.|          .|||.|:|.|        .:..|.::|   .:.|..::        :
Mouse    14 PEEIRNLLADVETFVADTLKGENLSKKA--------KEKRESLIK---KIKDVKSV--------Y 59

  Fly   482 LWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQ 546
            |..|:..|:|:..|...:.||      .|     .||..:.|                     ::
Mouse    60 LQEFQDKGDAEDGDEYDDPFA------GP-----ADTISLAS---------------------ER 92

  Fly   547 FISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYK--- 608
            :...:.|.::|...|....:.|       ||.|                |.|:|.|:...:.   
Mouse    93 YDKDDDGPSDGNQFPPIAAQDL-------PFVI----------------KAGYLEKRRKDHSFLG 134

  Fly   609 -SWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIH----DRSKPHCFELFATGGADIIK 668
             .|::||..|:....||:....||:.:|...::...||..:    |..|..|||:          
Mouse   135 FEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEI---------- 189

  Fly   669 ACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL 703
             |..|..         :|:.:||:.:|.:||:::|
Mouse   190 -CAPDKR---------IYQFTAASPKDAEEWVQQL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 26/159 (16%)
PH_GRP1-like 592..710 CDD:269954 29/120 (24%)
PH 596..708 CDD:278594 29/116 (25%)
Skap2NP_061243.1 Homodimerization 14..64 12/68 (18%)
PH_Skap-hom_Skap2 117..222 CDD:270181 30/134 (22%)
PH 117..215 CDD:278594 30/134 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..292
SH3 300..352 CDD:302595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.