DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Fbxo8

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_056606.2 Gene:Fbxo8 / 50753 MGIID:1354696 Length:319 Species:Mus musculus


Alignment Length:317 Identity:80/317 - (25%)
Similarity:133/317 - (41%) Gaps:78/317 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 SNSQSESERNSNIHKTNKYTSKNNNNDSKRESQQS-----NLCESCRMLLDRNYINTEQSDNLVI 362
            |..||....:|||..|           |.|:..|.     :|.::.:......:||.|       
Mouse    26 SREQSRRVASSNISHT-----------SHRKQAQGGIDIYHLLKARKSKEQEGFINLE------- 72

  Fly   363 LRRPSKQIKDELC-EVVSEMEALD------VPED-----------CKHS-------NKD------ 396
                  .:..||. .::|.:.|.|      |.:|           ||.:       ||:      
Mouse    73 ------MLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCSIYNKNPPLGFS 131

  Fly   397 -----KQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFN 456
                 .|:..|...||.:|::|:.|.:...:|...|:::|.|::....||...:..||.|:    
Mouse   132 FRKLYMQLDEGSLTFNANPEEGVSYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIYLDER---- 192

  Fly   457 EDVLKAFVALHDFTNLILVQALRQFLWSFRLPGE-AQKIDRMMETFAQRYCQLNPDIF----TNT 516
            .|||...|.||:|.|..|..|||:|......|.| .:.::.::..|:.|:|..|||:.    .:.
Mouse   193 RDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSP 257

  Fly   517 DTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFI-SMNRGINNGGDLPRGLLESLYESI 572
            |..|||.:::|:|:..|.:|.||:|.:..:|| :..|...|   :....:..||::|
Mouse   258 DAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQN---ISEDFVGHLYDNI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 55/182 (30%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
Fbxo8NP_056606.2 F-box-like 74..112 CDD:372399 7/37 (19%)
Sec7 133..312 CDD:238100 55/186 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.