DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Cyth4

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_017450546.1 Gene:Cyth4 / 500906 RGDID:1564842 Length:411 Species:Rattus norvegicus


Alignment Length:360 Identity:229/360 - (63%)
Similarity:287/360 - (79%) Gaps:1/360 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 KQIKDELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAH 432
            :::|||:.:|.::::..:..|:.:.:.|:|:|.||||||||||.|||:||.|::||..|.||:|.
  Rat    51 QKLKDEIADVFAQIDCFESTEESRMAQKEKEMCIGRKKFNMDPAKGIQYLTEHKLLTSDVQDIAQ 115

  Fly   433 FLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRM 497
            ||||||||||||||.|||||:..|..||:|||..|:|.||.||||||||||||||||||||||||
  Rat   116 FLYKGEGLNKTAIGTYLGEKDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRM 180

  Fly   498 METFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPR 562
            ||.||.|||..||.:|.:|||||||||::|||||.||||:|:|:|..:.|:|||||||:|.|||.
  Rat   181 MEAFAARYCLCNPGVFRSTDTCYVLSFSVIMLNTGLHNPNVRDRPHFEHFVSMNRGINSGSDLPE 245

  Fly   563 GLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEY 627
            ..|.:|::||::|||.||:|||:||.|||||||:||||.|.|||.|:||||||||.||||||||:
  Rat   246 EQLRNLFDSIKSEPFSIPEDDGSDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEF 310

  Fly   628 TTDKEPRGIIPLENISVREIHDRSKPHCFELF-ATGGADIIKACKTDSEGKVVEGKHTVYRMSAA 691
            ||||||||||||||:||:::.|..||.|.||: .:.....|||||||.:||||||||..||:|||
  Rat   311 TTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGKVVEGKHESYRISAA 375

  Fly   692 TEEDQQEWIKRLTQSISHNPFYDILVQRKKKALSK 726
            ..|::.:||:.:..||:..||||:|..||||.:.|
  Rat   376 NAEERDQWIEAIRASITRVPFYDLLSARKKKIVGK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 125/179 (70%)
PH_GRP1-like 592..710 CDD:269954 76/118 (64%)
PH 596..708 CDD:278594 71/112 (63%)
Cyth4XP_017450546.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 169 1.000 Domainoid score I3702
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 522 1.000 Inparanoid score I1212
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000619
OrthoInspector 1 1.000 - - otm46031
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10663
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X419
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.