DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment step and OSBP

DIOPT Version :9

Sequence 1:	NP_001036375.2	Gene:	step / 35425	FlyBaseID:	FBgn0086779	Length:	727	Species:	Drosophila melanogaster
Sequence 2:	NP_002547.1	Gene:	OSBP / 5007	HGNCID:	8503	Length:	807	Species:	Homo sapiens

Alignment Length:	112	Identity:	30/112 - (26%)
Similarity:	49/112 - (43%)	Gaps:	30/112 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   596 KEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEP--RGIIPL--ENISVREIHDRSKPHCF 656
            :||||:|.....|.::||||:|::..|.|:....:...  ||.|.|  .||:|.:       .|.
Human    91 REGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVED-------SCN 148

  Fly   657 ELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL 703
            .:.:.|||.                   .|.:.|::|.::|.|:..|
Human   149 FIISNGGAQ-------------------TYHLKASSEVERQRWVTAL 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
step	NP_001036375.2	Sec7	397..577	CDD:279680
		PH_GRP1-like	592..710	CDD:269954	30/112 (27%)
		PH	596..708	CDD:278594	30/112 (27%)
OSBP	NP_002547.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	61..86
		PH_OSBP_ORP4	91..189	CDD:270101	30/112 (27%)
		PH	91..181	CDD:278594	30/112 (27%)
		Phosphatidylinositol 4-phosphate binding. /evidence=ECO:0000250\|UniProtKB:P35844	117..122		2/4 (50%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	329..353
		FFAT. /evidence=ECO:0000269\|PubMed:24209621	358..364
		Sterol binding. /evidence=ECO:0000250	406..457
		Oxysterol_BP	418..787	CDD:279564
		Phosphatidylinositol 4-phosphate binding. /evidence=ECO:0000250\|UniProtKB:P35844	493..496
		Phosphatidylinositol 4-phosphate binding. /evidence=ECO:0000250\|UniProtKB:P35844	522..523
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	710..759
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910