DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and zap70

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001006825.1 Gene:zap70 / 448557 XenbaseID:XB-GENE-956409 Length:609 Species:Xenopus tropicalis


Alignment Length:264 Identity:56/264 - (21%)
Similarity:94/264 - (35%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 KSDIKIALKPPPKPRSPSMAPYTSVATYNITKLAPDSPPPASPTLSTQTVNCSDVTTKV------ 196
            |||..:|:.....|.|         .|::|   ||.:.||:.|.:.....|....|.:.      
 Frog   242 KSDGIMAVLKESCPNS---------CTFSI---APAAAPPSLPKIRQAASNSDGYTPEPFIGKSR 294

  Fly   197 -----TEVQRLPCDEPNTELISKRTEYKHTTITTTTRTLIVSRPVELLLNENGEI------IARR 250
                 |.|...|..:|.        |.|.       |.|.|.|  ||||.:..|:      ..::
 Frog   295 ILPMDTSVYESPYSDPE--------ELKE-------RKLFVKR--ELLLIDEVELGSGNFGCVKK 342

  Fly   251 SPRKSRSNSLG---RMLDVQNEIGTGGLFM-EADPCSKNSLPPPPYIDDMRFIDDSSNSQSESER 311
            ...|.:...:.   ::|.||:|.......| ||:...:..   .|||..|..:.::.|.....|.
 Frog   343 GVYKLKKRQIDVAIKVLKVQDEKNVRDEMMKEAEIMHQLD---NPYIVRMIGVCEAENLMLVMEM 404

  Fly   312 NSNIHKTNKYTSKNNNNDSKRESQQSNLCE-------SCRMLLDRNYINTE-QSDNLVILRRPSK 368
            .|. ...||:...     .|.....||:.|       ..:.|..:|:::.: .:.|::::.:...
 Frog   405 ASG-GPLNKFLGA-----KKDVIPMSNIVELMHQVSIGMKYLEGKNFVHRDLAARNVLMVNQHYA 463

  Fly   369 QIKD 372
            :|.|
 Frog   464 KISD 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
zap70NP_001006825.1 SH2_N-SH2_Zap70_Syk_like 8..111 CDD:198191
SH2_C-SH2_Zap70 152..256 CDD:198265 4/13 (31%)
PKc_like 321..589 CDD:389743 32/158 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.