DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment step and akt2l

DIOPT Version :9

Sequence 1:	NP_001036375.2	Gene:	step / 35425	FlyBaseID:	FBgn0086779	Length:	727	Species:	Drosophila melanogaster
Sequence 2:	XP_021334818.1	Gene:	akt2l / 403146	ZFINID:	ZDB-GENE-040121-5	Length:	625	Species:	Danio rerio

Alignment Length:	113	Identity:	28/113 - (24%)
Similarity:	50/113 - (44%)	Gaps:	22/113 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   596 KEGWLWKQGGRYKSWKRRWFIL-NDNCLYYFEYTTDKEPRGIIPLENISVREIH----DRSKPHC 655
            |||||.|:|...|:|:.|:||| :|.....::...:...:...||.|.||.|..    :|.:|:.
Zfish     8 KEGWLLKRGEYIKTWRPRYFILKSDGSFIGYKEKPELTDQSCAPLNNFSVEECQLMKTERPRPNT 72

  Fly   656 FELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRL 703
            |.:.......:|:               ..:.:.::.|.|  ||::.:
Zfish    73 FMIRCLQWTTVIE---------------RTFHVDSSDERD--EWMRAI 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
step	NP_001036375.2	Sec7	397..577	CDD:279680
		PH_GRP1-like	592..710	CDD:269954	28/113 (25%)
		PH	596..708	CDD:278594	28/113 (25%)
akt2l	XP_021334818.1	PH_PKB	4..111	CDD:269947	28/113 (25%)
		PKc_like	153..462	CDD:328722
		PKc_like	<423..551	CDD:328722
		S_TK_X	553..621	CDD:214529
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910