DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and uqcrfs1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_988911.1 Gene:uqcrfs1 / 394506 XenbaseID:XB-GENE-5746219 Length:273 Species:Xenopus tropicalis


Alignment Length:286 Identity:49/286 - (17%)
Similarity:88/286 - (30%) Gaps:119/286 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 RSPSMAPYTSVATYNIT-KLAPDSPPPASPTLSTQTVNCSDVTTKVTEVQRLPCDEPNTELISKR 215
            ||.|:|||.|..:|.:. :|.|                                      |:|. 
 Frog     7 RSGSVAPYLSATSYAVAGQLKP--------------------------------------LVSG- 32

  Fly   216 TEYKHTTITTTTRTLIVSRPVELLLNENGEIIARRSPRKSRSNSLGRMLDVQNEIGTGGLFMEAD 280
                           :|.:..::||:.....:.|.|              :..:...|||...|.
 Frog    33 ---------------VVLQADKVLLDVKKPFLCRES--------------LNGQAPNGGLSASAG 68

  Fly   281 ----PCSK---NSLPPPPYIDDMR--FIDDSSNSQSESERNSNIH------------------KT 318
                .|.:   :.:..|.:.|..|  .:|.:.:||:.|:...:..                  .|
 Frog    69 INGAACVRFLHSDVTVPDFSDYRRPEVLDSTKSSQTSSDSRKSFSYLVTGVTAVATAYAAKNAVT 133

  Fly   319 NKYTSKNNNND----SKRESQQSNLCESCRMLLDRNYINTEQSDNLVILRRPSKQIKDELCEVVS 379
            ...||.:.:.|    ||.|.:.|::.|.      :|.....:...|.:..|.:|:|..|     :
 Frog   134 QFVTSMSASADVLAMSKIEIKLSDIPEG------KNMAFKWRGKPLFVRHRTAKEIDQE-----A 187

  Fly   380 EMEALDVPEDCKHSNKDKQMSIGRKK 405
            ::...|:        :|.|..:.|.|
 Frog   188 QVNLTDL--------RDPQHDLDRVK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 3/9 (33%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
uqcrfs1NP_988911.1 Ubiq-Cytc-red_N 2..76 CDD:370333 22/136 (16%)
UCR_TM 79..144 CDD:367251 10/64 (16%)
Rieske_cytochrome_bc1 150..273 CDD:239552 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.