DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment step and plek

DIOPT Version :9

Sequence 1:	NP_001036375.2	Gene:	step / 35425	FlyBaseID:	FBgn0086779	Length:	727	Species:	Drosophila melanogaster
Sequence 2:	NP_957135.1	Gene:	plek / 393814	ZFINID:	ZDB-GENE-040426-1506	Length:	352	Species:	Danio rerio

Alignment Length:	136	Identity:	35/136 - (25%)
Similarity:	61/136 - (44%)	Gaps:	33/136 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   596 KEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFA 660
            :||:|.|:|....|||..|.:|.|:.:.:|:..||:..:|:|||:
Zfish     7 REGYLVKKGTVLNSWKAVWVVLKDDAIEFFKKKTDRNAKGMIPLK-------------------- 51

  Fly   661 TGGADIIKACKTDSEG----KVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHNPFYDILVQRKK 721
              ||.:...|:..|:.    ||...|:..:...|...|:::.|:|.:.::|:       .:|..|
Zfish    52 --GATLTSPCQDFSKRALVFKVSTAKNQDHYFQATHLEEREHWVKDIRRAIT-------CLQGGK 107

  Fly   722 KALSKS 727
            |...||
Zfish   108 KFARKS 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
step	NP_001036375.2	Sec7	397..577	CDD:279680
		PH_GRP1-like	592..710	CDD:269954	30/117 (26%)
		PH	596..708	CDD:278594	29/115 (25%)
plek	NP_957135.1	PH1_Pleckstrin_2	3..110	CDD:270113	33/131 (25%)
		PH	5..100	CDD:278594	29/114 (25%)
		DEP_PLEK1	125..223	CDD:239892
		PH2_Pleckstrin_2	239..348	CDD:270114
		PH	245..349	CDD:278594
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910