DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Dapp1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001102038.1 Gene:Dapp1 / 362046 RGDID:1310189 Length:279 Species:Rattus norvegicus


Alignment Length:219 Identity:62/219 - (28%)
Similarity:83/219 - (37%) Gaps:67/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 TSLHNPSVKDKPTVDQF------ISMNRGINNGGDL---------------------------PR 562
            |.|::.||:.|.:|..|      .|...|.|....|                           ||
  Rat    67 TGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEYSSLKDFVKHFANQPLIGSETGTLIVLKHPYPR 131

  Fly   563 GLLE-SLYESIRTEPFKIPQDDGNDLMHTFFNPD---KEGWLWKQGGRYKSWKRRWFILNDNCLY 623
            .:.| |:|||:|...........|||:.|  .|.   |||:|.||||..|:||.|||.|..|.|.
  Rat   132 QVEEPSIYESVRVHTAMQTGRTENDLVPT--APSLGTKEGYLTKQGGLVKTWKTRWFTLQRNELK 194

  Fly   624 YFEYTTDKEPRGIIPLENIS-VREIHDRSKPHCFEL---FATGGADIIKACKTDSEGKVVEGKHT 684
            ||:.....||..|:.|...| |:..:.:.:.:||.|   |.|                       
  Rat   195 YFKDQMSPEPIRILDLTECSAVQFDYSQDRVNCFCLVFPFRT----------------------- 236

  Fly   685 VYRMSAATEEDQQEWIKRLTQSIS 708
             :.:.|.|..:..||||.|...:|
  Rat   237 -FYLCAKTGVEADEWIKILRWKLS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 19/79 (24%)
PH_GRP1-like 592..710 CDD:269954 39/124 (31%)
PH 596..708 CDD:278594 37/115 (32%)
Dapp1NP_001102038.1 SH2_DAPP1_BAM32_like 28..119 CDD:198218 11/51 (22%)
PH_DAPP1 163..258 CDD:269977 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.