DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Sec71

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster


Alignment Length:410 Identity:120/410 - (29%)
Similarity:187/410 - (45%) Gaps:99/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 ELISKRTEYKHTTITTTTRTLIVSRP-VELLLNENGEIIARRSPRKSRSNSLGRMLDVQNEIGTG 273
            |..|...|:|...|...||....::. |::.:|.:.:.        |.:|...|:::..::|..|
  Fly   429 EANSSSFEHKWMVIQALTRICADAQSVVDIYVNYDCDF--------SAANLFERLVNDLSKIAQG 485

  Fly   274 --GLFMEADPCSKNS----------------------------LPPPPYIDDMRFIDDSSNSQSE 308
              .|.:.|:|..:.|                            :|.||    |:....:|..|.:
  Fly   486 RQALELGANPMQEKSMRIRGLECLVSILKCMVEWSKDLYVNPNMPVPP----MQVQSPTSTEQDQ 546

  Fly   309 SERNSNIHKTNKYTSKNNNNDSKRESQQSNLCESCRMLLDRNYINTEQSDNLVILRRPSKQIKDE 373
            ::.......:....|.|:|.:                                            
  Fly   547 ADTTIQTMHSGSSHSLNSNQE-------------------------------------------- 567

  Fly   374 LCEVVSEMEALDVPEDCKHSNKDKQ-MSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKG 437
                    :..|:||..:.....|: |..|.:.||..|:||:::|.|.:||.....|:|.:|::.
  Fly   568 --------QLQDLPEALEERKMRKEVMETGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHED 624

  Fly   438 EGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFA 502
            |.|:||.||:|:||.:|.:::|:.|::...||..:.:|.|||..|..||||||||||||:||.||
  Fly   625 ERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFA 689

  Fly   503 QRYCQLNP--DIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFISMNRGINNG-GDLPRGL 564
            .|||:.||  .:|.:.||.|||:|:||||.|.||:|.||.|.|.:|:|.|||||::. .|||...
  Fly   690 SRYCECNPKNQLFQSADTVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEY 754

  Fly   565 LESLYESIRTEPFKIPQDDG 584
            |.|:|:.|.....|:..:.|
  Fly   755 LSSIYDEISEHEIKMKNNSG 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 88/183 (48%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 120/410 (29%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549 9/35 (26%)
Sec7 582..767 CDD:279680 88/184 (48%)
DUF1981 1080..1161 CDD:286414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452075
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.