DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Gbf1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_006231558.1 Gene:Gbf1 / 309451 RGDID:1307160 Length:1895 Species:Rattus norvegicus


Alignment Length:232 Identity:77/232 - (33%)
Similarity:131/232 - (56%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 CEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLR--HDPQDVAHFLYKG 437
            |.:....|.:::      .||.|.:..|.::||..|||||::|.|..||.  .|..:||.:|.:.
  Rat   719 CLLPDPRELIEI------KNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLREN 777

  Fly   438 EGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFA 502
            ..|:|..||:::.::.  |.|:|::||:...|..|.|.:|||.:|.:|||||||..|.|::|.|.
  Rat   778 PRLDKKMIGEFVSDRK--NMDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIHRLLEVFT 840

  Fly   503 QRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDK---PTVDQFISMNRGINNGGDLPRGL 564
            :.:...|...|.|:|.|:.|::|:|||||..||.:|:.:   .|:::|....:|:|.|.|..:.:
  Rat   841 EHWRSCNGSPFANSDACFALAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDFEQDI 905

  Fly   565 LESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLW 601
            ||.:|.:|:.|...:|::....:        :|.::|
  Rat   906 LEDMYHAIKNEEIVMPEEQTGLV--------RENYVW 934

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 70/184 (38%)
PH_GRP1-like 592..710 CDD:269954 2/10 (20%)
PH 596..708 CDD:278594 2/6 (33%)
Gbf1XP_006231558.1 Sec7_N 434..579 CDD:289549
Sec7 733..918 CDD:279680 71/186 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.