DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Arfgef2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_851597.2 Gene:Arfgef2 / 296380 RGDID:631430 Length:1791 Species:Rattus norvegicus


Alignment Length:259 Identity:104/259 - (40%)
Similarity:145/259 - (55%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 YINTEQSDNLVILRRPSKQIKD-------ELCEVVSEMEALD------VPEDCKHSNKDKQ---- 398
            |:|......|...|.|.:::.|       ..|.|.|....:.      :|:|.:.....||    
  Rat   589 YVNPNHQATLGQERLPDQEMGDGKGLDMARRCSVTSVESTVSSGTQTAIPDDPEQFEVIKQQKEI 653

  Fly   399 MSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAF 463
            :..|.:.||..||:||::|.|..:|....:|:|.||::.|.|:.|.:|::||:...||::|:.|:
  Rat   654 IEHGIELFNKKPKRGIQFLQEQGMLGAAVEDIAQFLHQEERLDSTQVGEFLGDSTRFNKEVMYAY 718

  Fly   464 VALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRY--CQLNPDIFTNTDTCYVLSFAI 526
            |...||.....|.|||.||..||||||||||||:||.||.||  |.....:|.:.||.|||:::|
  Rat   719 VDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSI 783

  Fly   527 IMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHT 590
            |||.|.||:|.||:|.|.:|:|.||||||:..|||...|.|:||.|  |..||...:..:  ||
  Rat   784 IMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEI--EGKKIAMKETKE--HT 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 89/185 (48%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
Arfgef2NP_851597.2 DCB, DCB:DCB domain and DCB:HUS domain interaction. /evidence=ECO:0000250 2..224
PLN03076 11..1718 CDD:215560 104/259 (40%)
DCB 28..198 CDD:292830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..292
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..350
Sec7_N 377..531 CDD:289549
HUS, DCB:HUS domain interaction. /evidence=ECO:0000250 515..535
Sec7 650..834 CDD:279680 87/185 (47%)
DUF1981 1174..1255 CDD:286414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.