DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Appl1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_038951064.1 Gene:Appl1 / 290537 RGDID:1309388 Length:720 Species:Rattus norvegicus


Alignment Length:441 Identity:76/441 - (17%)
Similarity:159/441 - (36%) Gaps:143/441 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 SESERNSNIHKTNK----YTSKNNNNDSKRESQQSNL---------CESCRMLLDRNYINTEQSD 358
            :::|.::..|.|:|    |..:........|...|.|         ..||..:|     :|:.:|
  Rat    50 AQNELSAATHLTSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVL-----STQLAD 109

  Fly   359 NLVILRRPSKQIKD-ELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVENRL 422
            .::.   |..|.|: :|.|:::..|...:      ::.|...:|.|  ::...||.     ||..
  Rat   110 AMMF---PISQFKERDLKEILTLKEVFQI------ASNDHDAAINR--YSRLSKKR-----ENDK 158

  Fly   423 LRHD-PQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDF---TNLILVQALRQFLW 483
            :::: .:||                 |...|.. ::.::..|.||:..   ..:.|::.|..::.
  Rat   159 VKYEVTEDV-----------------YTSRKKQ-HQTMMHYFCALNTLQYKKKIALLEPLLGYMQ 205

  Fly   484 S----FRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTV 544
            :    |::..|  .::..:|.|                        :..:.||:.|         
  Rat   206 AQISFFKMGSE--NLNGQLEEF------------------------LANIGTSVQN--------- 235

  Fly   545 DQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWL---WKQGGR 606
                 :.|.::...:..:..:|.|  .:.::|..:|..|............|.|:|   .|.|..
  Rat   236 -----VRREMDGDVETMQQTIEDL--EVASDPLYLPDPDPTKFPVNRNLTRKAGYLNARNKTGLV 293

  Fly   607 YKSWKRRWFILNDNCLYYFEYTTDKEPRG------IIPLENISVREIHDRSKPHCFELFATGGAD 665
            ..:|.|:::......|.       .:.||      .:.::|.||..:....:.:||::       
  Rat   294 SSTWDRQFYFTQGGNLM-------SQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQI------- 344

  Fly   666 IIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEW---IKRLTQSI--SHNP 711
                  |..:||    |.::  :.|.:::|.:||   |..:::.|  |.||
  Rat   345 ------TSFDGK----KSSI--LQAESKKDHEEWICTINNISKQIYLSENP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 25/187 (13%)
PH_GRP1-like 592..710 CDD:269954 26/131 (20%)
PH 596..708 CDD:278594 25/125 (20%)
Appl1XP_038951064.1 BAR_APPL1 20..234 CDD:153315 41/248 (17%)
BAR-PH_APPL 252..376 CDD:270067 29/151 (19%)
PTB_APPL 506..637 CDD:269980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.