DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and CYTH4

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_037517.1 Gene:CYTH4 / 27128 HGNCID:9505 Length:394 Species:Homo sapiens


Alignment Length:360 Identity:228/360 - (63%)
Similarity:289/360 - (80%) Gaps:1/360 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 KQIKDELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAH 432
            :::|||:.:|.::::..:..|:.:.:.|:|::.||||||||||.|||:|.:|::||..|.||:|.
Human    34 QKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIAR 98

  Fly   433 FLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRM 497
            ||||||||||||||.||||::..|..||:|||..|:|.||.||||||||||||||||||||||||
Human    99 FLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRM 163

  Fly   498 METFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPR 562
            ||.||.|||..||.:|.:|||||||||:|||||||||||:|:|:|..::|:|||||||||.|||.
Human   164 MEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPE 228

  Fly   563 GLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEY 627
            ..|.:|::||::|||.||:||||||.|||||||:||||.|.|||.|:||||||||.||||||||:
Human   229 DQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEF 293

  Fly   628 TTDKEPRGIIPLENISVREIHDRSKPHCFELF-ATGGADIIKACKTDSEGKVVEGKHTVYRMSAA 691
            ||||||||||||||:||:::.|..||.|.||: .:.....|||||||.:|:||||||..||:||.
Human   294 TTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISAT 358

  Fly   692 TEEDQQEWIKRLTQSISHNPFYDILVQRKKKALSK 726
            :.|::.:||:.:..||:..||||::..||||..||
Human   359 SAEERDQWIESIRASITRVPFYDLVSTRKKKIASK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 125/179 (70%)
PH_GRP1-like 592..710 CDD:269954 74/118 (63%)
PH 596..708 CDD:278594 69/112 (62%)
CYTH4NP_037517.1 Sec7 61..243 CDD:279680 126/181 (70%)
PH_GRP1-like 258..376 CDD:269954 74/117 (63%)
PH 262..374 CDD:278594 68/111 (61%)
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 268..275 4/6 (67%)
C-terminal autoinhibitory region. /evidence=ECO:0000250 386..394 6/8 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3769
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 520 1.000 Inparanoid score I1273
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000619
OrthoInspector 1 1.000 - - otm41895
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.