DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and APPL1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_036228.1 Gene:APPL1 / 26060 HGNCID:24035 Length:709 Species:Homo sapiens


Alignment Length:441 Identity:76/441 - (17%)
Similarity:160/441 - (36%) Gaps:143/441 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 SESERNSNIHKTNK----YTSKNNNNDSKRESQQSNL---------CESCRMLLDRNYINTEQSD 358
            :::|.::..|.|:|    |..:........|...|.|         ..||..:|     :|:.:|
Human    50 AQNELSAATHLTSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVL-----STQLAD 109

  Fly   359 NLVILRRPSKQIKD-ELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVENRL 422
            .::.   |..|.|: :|.|:::..|...:      ::.|...:|.|  ::...||.     ||..
Human   110 AMMF---PITQFKERDLKEILTLKEVFQI------ASNDHDAAINR--YSRLSKKR-----ENDK 158

  Fly   423 LRHD-PQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDF---TNLILVQALRQFLW 483
            :::: .:||                 |...|.. ::.::..|.||:..   ..:.|::.|..::.
Human   159 VKYEVTEDV-----------------YTSRKKQ-HQTMMHYFCALNTLQYKKKIALLEPLLGYMQ 205

  Fly   484 S----FRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTV 544
            :    |::..|  .::..:|.|                        :..:.||:.|         
Human   206 AQISFFKMGSE--NLNEQLEEF------------------------LANIGTSVQN--------- 235

  Fly   545 DQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWL---WKQGGR 606
                 :.|.:::..:..:..:|.|  .:.::|..:|..|............|.|:|   .|.|..
Human   236 -----VRREMDSDIETMQQTIEDL--EVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLV 293

  Fly   607 YKSWKRRWFILNDNCLYYFEYTTDKEPRG------IIPLENISVREIHDRSKPHCFELFATGGAD 665
            ..:|.|:::......|.       .:.||      .:.::|.||..:....:.:||::       
Human   294 SSTWDRQFYFTQGGNLM-------SQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQI------- 344

  Fly   666 IIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEW---IKRLTQSI--SHNP 711
                  |..:||    |.::  :.|.:::|.:||   |..:::.|  |.||
Human   345 ------TSFDGK----KSSI--LQAESKKDHEEWICTINNISKQIYLSENP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 25/187 (13%)
PH_GRP1-like 592..710 CDD:269954 26/131 (20%)
PH 596..708 CDD:278594 25/125 (20%)
APPL1NP_036228.1 Required for RAB5A binding 1..428 76/441 (17%)
BAR_APPL1 20..234 CDD:153315 41/248 (17%)
BAR-PH_APPL 252..376 CDD:270067 29/151 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..434
F&H 403..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..491
PTB_APPL 490..625 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.