DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Arhgap22

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_006519017.1 Gene:Arhgap22 / 239027 MGIID:2443418 Length:738 Species:Mus musculus


Alignment Length:180 Identity:46/180 - (25%)
Similarity:81/180 - (45%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 ISMNRGI-NNGG------------DLPRGLLESLYESIRTEPFKIPQDD---GNDLMHTFFNPD- 595
            :.:.||| .|.|            ..|:..|.|:....|::...:.:..   |..|:.....|. 
Mouse     1 MKIRRGIQENSGRAAAPHNLKGIFQHPQNSLASVVTPARSKSLVMGEQSRSPGRPLVPHKLGPVL 65

  Fly   596 KEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRE-IHDRSKP--HCFE 657
            |.|||.||....|:|::|||:|..:.|:|::...:.:|:|.|.|:...|.| :.|...|  |.||
Mouse    66 KAGWLRKQRSIMKNWQQRWFVLRGDQLFYYKDKDESKPQGFISLQGTQVTELLPDPEDPGKHLFE 130

  Fly   658 LFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSI 707
            : ..|||         :|.:.|........:.|:::.|.::|::.:.:.|
Mouse   131 I-TPGGA---------TEREKVPANPEALLLMASSQRDMEDWVQAIRRVI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 9/41 (22%)
PH_GRP1-like 592..710 CDD:269954 35/120 (29%)
PH 596..708 CDD:278594 34/115 (30%)
Arhgap22XP_006519017.1 PH-like 62..177 CDD:388408 35/119 (29%)
RhoGAP_ARHGAP22_24_25 193..391 CDD:239855
Macoilin <529..>719 CDD:370635
HCR <638..719 CDD:284517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.