Sequence 1: | NP_001036375.2 | Gene: | step / 35425 | FlyBaseID: | FBgn0086779 | Length: | 727 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036020963.1 | Gene: | Arhgap24 / 231532 | MGIID: | 1922647 | Length: | 804 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 64/196 - (32%) | Gaps: | 72/196 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 573 RTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGII 637
Fly 638 PLENISVREIH--DRSKPHCFELFATGGADIIKACKTDSEGKVVE-------------------- 680
Fly 681 ----------------------------------GKHTVYRMSAATEEDQQEWIKRLTQSISHNP 711
Fly 712 F 712 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
step | NP_001036375.2 | Sec7 | 397..577 | CDD:279680 | 2/3 (67%) |
PH_GRP1-like | 592..710 | CDD:269954 | 40/173 (23%) | ||
PH | 596..708 | CDD:278594 | 39/167 (23%) | ||
Arhgap24 | XP_036020963.1 | PH-like | 20..186 | CDD:418428 | 42/173 (24%) |
RhoGAP_ARHGAP22_24_25 | 186..384 | CDD:239855 | |||
Smc | <705..>791 | CDD:224117 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |