DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Arhgap24

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_036020963.1 Gene:Arhgap24 / 231532 MGIID:1922647 Length:804 Species:Mus musculus


Alignment Length:196 Identity:47/196 - (23%)
Similarity:64/196 - (32%) Gaps:72/196 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   573 RTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGII 637
            |.|..:.||..|.       ...|.|||.||||..|:|..|||:|..:.||||:...:.:|.|.|
Mouse     4 RCESTESPQGQGR-------QNTKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTI 61

  Fly   638 PLENISVREIH--DRSKPHCFELFATGGADIIKACKTDSEGKVVE-------------------- 680
            .|....|.| |  :...|..|......||.       ..|..:||                    
Mouse    62 FLHGNKVIE-HPCNEENPGKFLFEVVPGAQ-------SEESAIVELVVLKPLPISGATDNGAAWQ 118

  Fly   681 ----------------------------------GKHTVYRMSAATEEDQQEWIKRLTQSISHNP 711
                                              ..|..|.:.|:|:.|.::|:|.:.:.| ..|
Mouse   119 RSIQTFCFLWTSVSLLADQNSELQGPGGERDRMTANHESYLLMASTQNDMEDWVKSIRRVI-WGP 182

  Fly   712 F 712
            |
Mouse   183 F 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 2/3 (67%)
PH_GRP1-like 592..710 CDD:269954 40/173 (23%)
PH 596..708 CDD:278594 39/167 (23%)
Arhgap24XP_036020963.1 PH-like 20..186 CDD:418428 42/173 (24%)
RhoGAP_ARHGAP22_24_25 186..384 CDD:239855
Smc <705..>791 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.