DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and MON2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_016874530.1 Gene:MON2 / 23041 HGNCID:29177 Length:1718 Species:Homo sapiens


Alignment Length:264 Identity:49/264 - (18%)
Similarity:80/264 - (30%) Gaps:114/264 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 AFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAI 526
            |..::|.|  .:..|.||.|..|:.:...:.|:.|              || .|....::.|..:
Human   355 AVESIHRF--CVQPQLLRSFCQSYDMKQHSTKVFR--------------DI-VNALGSFIQSLFL 402

  Fly   527 IMLNTSLHNPSVKDKPTVDQFISMNRGINN-GGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHT 590
            :             .||.:...|...|.|| ||.:..                            
Human   403 V-------------PPTGNPATSNQAGNNNLGGSVSA---------------------------- 426

  Fly   591 FFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGI-IPLENISVR--------E 646
               |...|.:...||             ...|..|||      ||. ||:..|:|:        |
Human   427 ---PANSGMVGIGGG-------------VTLLPAFEY------RGTWIPILTITVQGSAKATYLE 469

  Fly   647 IHDRSKP-------------HCFELFATGGADIIKACKTDSEGKV----VEGKHTVYRMSAATEE 694
            :.|:.:|             ||.       .|:::...:..||::    .|.:.|....|:.|:.
Human   470 MLDKVEPPTIPEGYAMSVAFHCL-------LDLVRGITSMIEGELGELETECQTTTEEGSSPTQS 527

  Fly   695 DQQE 698
            .:|:
Human   528 TEQQ 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 22/115 (19%)
PH_GRP1-like 592..710 CDD:269954 27/133 (20%)
PH 596..708 CDD:278594 26/129 (20%)
MON2XP_016874530.1 DCB 9..183 CDD:292830
Sec7_N 212..379 CDD:289549 8/25 (32%)
DUF1981 <873..932 CDD:286414
Mon2_C 935..1709 CDD:292823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.