DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Cyth2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_035311.1 Gene:Cyth2 / 19158 MGIID:1334255 Length:400 Species:Mus musculus


Alignment Length:381 Identity:245/381 - (64%)
Similarity:310/381 - (81%) Gaps:8/381 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 RMLLDRNYINTEQSDNLVILRRPSKQIKDELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNM 408
            ||.|:.  |...:.:.||.::|    :::||.|.:||:|.|:..|..|...::::|::|||||||
Mouse    16 RMELEN--IRRRKQELLVEIQR----LREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNM 74

  Fly   409 DPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLI 473
            ||||||::|||:.||::.|:::|.|||||||||||||||||||:.:.|..||.|||.||:||:|.
Mouse    75 DPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLN 139

  Fly   474 LVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSV 538
            ||||||||||||||||||||||||||.||||||..||.:|.:||||||||||:||||||||||:|
Mouse   140 LVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNV 204

  Fly   539 KDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWK- 602
            :|||.:::|::||||||.|||||..||.:||:|||.||||||:||||||.|||||||:||||.| 
Mouse   205 RDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKL 269

  Fly   603 QGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFATGG-ADI 666
            .|||.|:||||||||.|||||||||||||||||||||||:|:||:.|..||:||||:.... ..:
Mouse   270 GGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQL 334

  Fly   667 IKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHNPFYDILVQRKKK 722
            ||||||:::|:||||.|.|||:||.|:|::.||||.:..::|.:|||::|..|||:
Mouse   335 IKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 130/179 (73%)
PH_GRP1-like 592..710 CDD:269954 78/119 (66%)
PH 596..708 CDD:278594 73/113 (65%)
Cyth2NP_035311.1 Sec7 61..243 CDD:396096 130/181 (72%)
PH_GRP1-like 258..378 CDD:269954 78/119 (66%)
C-terminal autoinhibitory region. /evidence=ECO:0000250 387..395 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 290 1.000 Domainoid score I1540
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 526 1.000 Inparanoid score I1226
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000619
OrthoInspector 1 1.000 - - otm43943
orthoMCL 1 0.900 - - OOG6_103039
Panther 1 1.100 - - O PTHR10663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.