DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment step and nck-1

DIOPT Version :9

Sequence 1:	NP_001036375.2	Gene:	step / 35425	FlyBaseID:	FBgn0086779	Length:	727	Species:	Drosophila melanogaster
Sequence 2:	NP_001361996.1	Gene:	nck-1 / 180690	WormBaseID:	WBGene00006410	Length:	397	Species:	Caenorhabditis elegans

Alignment Length:	103	Identity:	21/103 - (20%)
Similarity:	37/103 - (35%)	Gaps:	37/103 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   608 KSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKT 672
            |:|   |.::||:           ...|.:|...:....|.|::|            ..||.
Worm    35 KNW---WKVMNDS-----------NSVGFVPSNYVRKESIVDKAK------------GTIKG--- 70

  Fly   673 DSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHN 710
                 :..|::   |.|....|::...|.||..|:::|
Worm    71 -----LARGRN---RSSDPEPEERLNGIARLAFSLNNN 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
step	NP_001036375.2	Sec7	397..577	CDD:279680
		PH_GRP1-like	592..710	CDD:269954	20/101 (20%)
		PH	596..708	CDD:278594	20/99 (20%)
nck-1	NP_001361996.1	SH3_Nck_1	5..55	CDD:212699	7/33 (21%)
		SH3_Nck_2	118..171	CDD:212700
		SH3_Nck_3	217..272	CDD:212701
		SH2_Nck_family	301..392	CDD:198196
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910