DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and gbf-1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001366879.1 Gene:gbf-1 / 176609 WormBaseID:WBGene00007703 Length:1975 Species:Caenorhabditis elegans


Alignment Length:324 Identity:96/324 - (29%)
Similarity:146/324 - (45%) Gaps:69/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 KHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDF 455
            :...:.:.::.|.:.||..|||||.:|.|..:|.||.|.:..:|.....|:|.||.||:..:.  
 Worm   627 EQKKRKRLIAEGTELFNQSPKKGIAFLREKGILGHDEQSLVQWLRTNPQLDKKAIADYICNRK-- 689

  Fly   456 NEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCY 520
            :.:||.|||....|.|..|..|||.||.:||||||:.:|..:|:.|::.:.:.|.:.|.:.|..:
 Worm   690 HAEVLNAFVKSFPFENTRLDVALRMFLETFRLPGESAEIALVMQHFSEEWFRANNEPFFHVDAAF 754

  Fly   521 VLSFAIIMLNTSLHNPSVK-DKP--TVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQD 582
            .||:||||||...|||..| .:|  |||.|.....|.|:..|....:|..:|::|:||...:|.:
 Worm   755 TLSYAIIMLNVDQHNPQAKRSQPPMTVDCFRRNLSGTNDSRDFDPEMLADMYQAIKTEEIVMPAE 819

  Fly   583 DGNDLMHTFFNPDKEGWLWK---------QGGRYKS---WKRRWFILNDNCLY---------YFE 626
            ....:        ||.::||         :|..|.:   |       ||:.|:         ...
 Worm   820 QKGTV--------KEDYMWKVLLRRGETAEGSFYHAPTGW-------NDHDLFAVCWGPAVAALS 869

  Fly   627 YTTDKEPRGIIPLENIS-------------VREIHDRSKPHCFEL--FAT----------GGAD 665
            |..||.....|..:.::             ::|:.|..   |..|  |.|          ||||
 Worm   870 YVFDKSEHEQILQKALTGYRKCAKIAAYYGMKEVFDNL---CIHLCKFTTLTSMRDGGAGGGAD 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 71/182 (39%)
PH_GRP1-like 592..710 CDD:269954 24/120 (20%)
PH 596..708 CDD:278594 24/116 (21%)
gbf-1NP_001366879.1 COG5307 354..>998 CDD:227623 96/324 (30%)
Sec7 631..814 CDD:396096 71/184 (39%)
PLN03209 <1696..1810 CDD:178748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.