DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and AgaP_AGAP001238

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_003435786.1 Gene:AgaP_AGAP001238 / 1281933 VectorBaseID:AGAP001238 Length:1618 Species:Anopheles gambiae


Alignment Length:153 Identity:34/153 - (22%)
Similarity:61/153 - (39%) Gaps:46/153 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 FNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLEN--------------- 641
            ::....|:|.|:......|:.|||:|..|.|:|:|......|.|:|.||.               
Mosquito    21 YDHSMHGYLHKRTSDNNKWQMRWFVLYQNLLFYYESEQSSRPSGLIFLEGCYCERLVSAPSISGP 85

  Fly   642 -ISV------REIHDRSKPHCFELFATGGADIIKAC-KTDSEGKVVEGKHTVYRMSAATEEDQQE 698
             ||.      :.|.:....|||.:           | :.:::.:        |.:.||||.:...
Mosquito    86 PISTSTGQAPKIIKEEKLQHCFTI-----------CYRRENQRQ--------YELRAATESECSA 131

  Fly   699 WIKRLTQSISHNPFYDILVQRKK 721
            ||..:.::    .|..:|:|:::
Mosquito   132 WIIAIREA----SFNKLLLQKEE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954 31/140 (22%)
PH 596..708 CDD:278594 31/134 (23%)
AgaP_AGAP001238XP_003435786.1 PH_RasGRF1_2 19..166 CDD:270081 34/153 (22%)
PH 25..140 CDD:278594 31/137 (23%)
RhoGEF 278..459 CDD:214619
PH-like 465..631 CDD:302622
RasGEF_N 696..>748 CDD:279012
REM <1269..1331 CDD:100121
RasGEF 1377..1555 CDD:279011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.