DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and AgaP_AGAP000864

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_003437123.1 Gene:AgaP_AGAP000864 / 1277378 VectorBaseID:AGAP000864 Length:343 Species:Anopheles gambiae


Alignment Length:110 Identity:41/110 - (37%)
Similarity:61/110 - (55%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 DKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELF 659
            |.||||.|:|...|||:||||:|..|.|:|||..|||||.|:|.||..:| |:.:.|:.:||::.
Mosquito    18 DLEGWLNKRGEMNKSWQRRWFVLKGNLLFYFEKRTDKEPLGMIILEGCTV-ELAEESEQYCFQII 81

  Fly   660 ATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLT 704
            ..|                  ..:..|.:|..::.:.::|:|.||
Mosquito    82 FHG------------------PNNRTYYLSTESQSNMEQWMKALT 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954 41/110 (37%)
PH 596..708 CDD:278594 40/109 (37%)
AgaP_AGAP000864XP_003437123.1 PH_Ses 11..129 CDD:270105 41/110 (37%)
PH 17..107 CDD:278594 39/107 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.