DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and AgaP_AGAP004989

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_001688613.1 Gene:AgaP_AGAP004989 / 1275815 VectorBaseID:AGAP004989 Length:1729 Species:Anopheles gambiae


Alignment Length:424 Identity:76/424 - (17%)
Similarity:133/424 - (31%) Gaps:170/424 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PLLERGSGSDSSPSSVCVRCSCNSITKSGD-RNETPTMATPKSDIKIALKPPPKPRSPSMAPYTS 161
            ||.:||.|.......:..:    ||..|.| ||..|::....:...::|    :.|.||....:|
Mosquito  1018 PLDQRGGGGSGGSGGMLEK----SIAPSNDVRNTEPSVEEASTRFGVSL----RKREPSTDSCSS 1074

  Fly   162 --------VATYNITKLAPDSPPP------ASPTLSTQTVNC----------------------S 190
                    :.|.......|..|||      |.|...|....|                      |
Mosquito  1075 LGSPADAMINTVGDPSSLPIPPPPPAKDLKADPKRVTNVPKCLQGDVVGGKRTAGPLHGTSDPAS 1139

  Fly   191 DVTTKVTEVQRLP--------CDEP----NTELISKRTEYKHTTITTTTRTLIVSRPVEL----- 238
            .:.:::.|...||        ..||    ..:.||   .||.:.:::..:.:.:|:...|     
Mosquito  1140 QLVSELAESMHLPKAPSPLTTAQEPQHHQQQQPIS---HYKSSDVSSLRKPVSMSKSTILPSTNA 1201

  Fly   239 LLNENGEI---------------------IARRSPRK--SRSNSLGRMLDVQNEI---------- 270
            ..|:|...                     .|:|:|.:  .:..|.|.::|.::.:          
Mosquito  1202 AANDNYSAATNAASGVPQPPFKAQLKKVDTAKRAPAQPAKKEESTGGIIDFKSRLRKVDQNNTEV 1266

  Fly   271 ----GTGGLFMEADPCSKNSLPPPPYIDDMRFIDDSSNSQS-----ESERNSNIHKTNKYTSKN- 325
                |:|| ....||.:.|             :|:::..|:     :|..|:|.:.|....:.| 
Mosquito  1267 SSNGGSGG-GESVDPPTSN-------------VDNNNKHQAGGNSLQSIHNNNFNTTASSNNSNG 1317

  Fly   326 ---NNNDSKRESQQS-----------------------------NLCESCRMLLDRNYIN----- 353
               ||||:...|..|                             ::..|.::||:.|.:|     
Mosquito  1318 NILNNNDNSASSSSSENENHRSAKKGETGTPMVVRNGTSISGKNSMDSSNKLLLENNELNSLKLK 1382

  Fly   354 -----------TEQSDNLVILRRPSKQIKDELCE 376
                       |...|:..::.....:||.||.:
Mosquito  1383 KTNVASTIVTGTAPIDSNKVIELKKTEIKIELSD 1416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
AgaP_AGAP004989XP_001688613.1 SH3_Abl 123..177 CDD:212784
SH2_ABL 182..277 CDD:198189
PTKc_Abl 296..558 CDD:270645
Pkinase_Tyr 303..554 CDD:285015
F_actin_bind 1624..1729 CDD:286063
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.