Sequence 1: | NP_001036375.2 | Gene: | step / 35425 | FlyBaseID: | FBgn0086779 | Length: | 727 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001688613.1 | Gene: | AgaP_AGAP004989 / 1275815 | VectorBaseID: | AGAP004989 | Length: | 1729 | Species: | Anopheles gambiae |
Alignment Length: | 424 | Identity: | 76/424 - (17%) |
---|---|---|---|
Similarity: | 133/424 - (31%) | Gaps: | 170/424 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 PLLERGSGSDSSPSSVCVRCSCNSITKSGD-RNETPTMATPKSDIKIALKPPPKPRSPSMAPYTS 161
Fly 162 --------VATYNITKLAPDSPPP------ASPTLSTQTVNC----------------------S 190
Fly 191 DVTTKVTEVQRLP--------CDEP----NTELISKRTEYKHTTITTTTRTLIVSRPVEL----- 238
Fly 239 LLNENGEI---------------------IARRSPRK--SRSNSLGRMLDVQNEI---------- 270
Fly 271 ----GTGGLFMEADPCSKNSLPPPPYIDDMRFIDDSSNSQS-----ESERNSNIHKTNKYTSKN- 325
Fly 326 ---NNNDSKRESQQS-----------------------------NLCESCRMLLDRNYIN----- 353
Fly 354 -----------TEQSDNLVILRRPSKQIKDELCE 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
step | NP_001036375.2 | Sec7 | 397..577 | CDD:279680 | |
PH_GRP1-like | 592..710 | CDD:269954 | |||
PH | 596..708 | CDD:278594 | |||
AgaP_AGAP004989 | XP_001688613.1 | SH3_Abl | 123..177 | CDD:212784 | |
SH2_ABL | 182..277 | CDD:198189 | |||
PTKc_Abl | 296..558 | CDD:270645 | |||
Pkinase_Tyr | 303..554 | CDD:285015 | |||
F_actin_bind | 1624..1729 | CDD:286063 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |