DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and AgaP_AGAP008738

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_314854.4 Gene:AgaP_AGAP008738 / 1275591 VectorBaseID:AGAP008738 Length:513 Species:Anopheles gambiae


Alignment Length:166 Identity:33/166 - (19%)
Similarity:64/166 - (38%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 KYTSKNNNNDSKRESQQSNLCESCRMLLDRNYINTEQSDNLVI-LRRPSKQIKDELCEVVSEMEA 383
            |:.:.:....|.|..:|...|.  .||::.:..:.|:.|..:: ...|:..:..|  :..:...|
Mosquito     3 KFVNSDTTTKSLRHGEQYENCS--EMLIEPDMTSLEELDPAILSCGLPAIVLNAE--DSAASASA 63

  Fly   384 LDVP----EDCKHSNKDKQMS---IGRKKFNMDPKKGIEYLVENRL-LRHDPQDVAHFL--YKGE 438
            :.||    ...:.:.:...|:   ..|:...:|..:..:|.:.:|. ..|.|..|....  ..|.
Mosquito    64 VAVPTTTTTTTRRTMRPSLMASPFAHRRPAAIDEPRTAQYPIWSRTGFNHQPDRVRRVSGGGGGG 128

  Fly   439 GLNKTAIGDYLGEKNDFNED---VLKAFVALHDFTN 471
            |.::...|.|..:.||...|   ....|...|:|:|
Mosquito   129 GGDEDLSGAYGRKGNDRQRDNGYNPPRFRRNHEFSN 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 19/84 (23%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
AgaP_AGAP008738XP_314854.4 EIF4E-T <208..>370 CDD:287454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.