DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Abl1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001106174.1 Gene:Abl1 / 11350 MGIID:87859 Length:1142 Species:Mus musculus


Alignment Length:343 Identity:72/343 - (20%)
Similarity:111/343 - (32%) Gaps:106/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SNWFSSLRRQPKNKKCSPGLGGSESVGRK---QPLQRSCLDLSTTRVGCDGCVSLEFFQSESPES 73
            :|.||:|.:  |.||.:|......|..|:   ||.:|...: ..:|..|:|..:|....:|..:|
Mouse   616 TNLFSALIK--KKKKMAPTPPKRSSSFREMDGQPDRRGASE-DDSRELCNGPPALTSDAAEPTKS 677

  Fly    74 RRSNSTFYVNTQNVSSAVFKD--------------------NRQPLLERGSGSDSSPSSV--CVR 116
            .:::     |...|.:..|::                    :|....|..||..||...:  | .
Mouse   678 PKAS-----NGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSC-S 736

  Fly   117 CSC--------------------------NSITKSGDRNETPTMATPKSD-------IKIALKPP 148
            .||                          :|.|..|.::|.|.:...::.       .|....||
Mouse   737 ASCMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPP 801

  Fly   149 PKPRSPSMAPYTSVATYNITKLAPDSPPPA-SPTLSTQTVNCSDVTTKVTEVQRLPCDEPNTELI 212
              ||........:...:..|:.:|.|.||: :|.|..:.|..|                |::.|.
Mouse   802 --PRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTAS----------------PSSGLS 848

  Fly   213 SKRTEYKHTT----ITTTTRTLIVSRPVELLLNENGEIIARRSPRKSRSNSLGRMLDVQNEIGTG 273
            .|....|.:.    ...|......|..|.|....:.|:..||  .|..|.|.||         ..
Mouse   849 HKEEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRR--HKHSSESPGR---------DK 902

  Fly   274 GLFMEADPCSKNSLPPPP 291
            |...:..|.     ||||
Mouse   903 GRLAKLKPA-----PPPP 915

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
Abl1NP_001106174.1 SH3_Abl 84..137 CDD:212784
SH2_ABL 142..235 CDD:198189
PTKc_Abl 254..516 CDD:270645
Pkinase_Tyr 261..512 CDD:285015
FABD 1018..1142 CDD:197885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.