DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Plekha5

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_006506926.1 Gene:Plekha5 / 109135 MGIID:1923802 Length:1270 Species:Mus musculus


Alignment Length:168 Identity:44/168 - (26%)
Similarity:74/168 - (44%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 NPD----KEGWLWKQGGR-YKSWKRRWFILNDNCLYYFEYTTDKEPRGI-----IPLENISVREI 647
            ||:    :.|||:||... .|.||:|||:|:|.||:|:.   |::..||     :|...|::...
Mouse   166 NPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYR---DEKEEGILGSILLPSFQIAMLTA 227

  Fly   648 HDR-SKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEED--QQEWIKRL------ 703
            .|. ::.:.|:. |.........| ||:      ||.....|.|..:..  |.|.:||:      
Mouse   228 EDHINRKYAFKA-AHPNMRTYYFC-TDT------GKEMELWMKAMLDAALVQTEPVKRITFNFRV 284

  Fly   704 ---------TQSISHNPFYDILVQ------RKKKALSK 726
                     |:..::.|.:.:|::      :|.|.:||
Mouse   285 DKITTDSASTKETNNIPNHRVLIRPEVQNHQKNKEISK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680
PH_GRP1-like 592..710 CDD:269954 38/144 (26%)
PH 596..708 CDD:278594 36/135 (27%)
Plekha5XP_006506926.1 WW 13..42 CDD:366073
WW 59..88 CDD:366073
PH_PEPP1_2_3 165..268 CDD:270068 33/112 (29%)
Smc <623..>864 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.