DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Gbf1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_006526643.1 Gene:Gbf1 / 107338 MGIID:1861607 Length:1862 Species:Mus musculus


Alignment Length:361 Identity:94/361 - (26%)
Similarity:177/361 - (49%) Gaps:62/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SKNSLPPPPY--------IDDMRFIDDSSNSQSESERNSNIHKTNK-------YTSKNNNNDSKR 332
            |||:.|....        :|.:..:.||:.|..:::..:.:::..|       :.:.:.|.::.:
Mouse   561 SKNAFPVSGQLYTTHLLSLDALLTVIDSTESHCQAKVLNTLNQQEKKETARPGFEAVDGNPETNK 625

  Fly   333 ESQQSNLCESCRMLLDR--------NYINTEQSD--------------NLVILRRPSKQIKDELC 375
            ..:.::..:|..:.||.        .:::||...              :....|:|.:    ..|
Mouse   626 SERATSDGKSTGVALDARGLHFPSGGWLSTEHGKPGCRDLEEAGDSGADKKFTRKPPR----FSC 686

  Fly   376 EVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLR--HDPQDVAHFLYKGE 438
            .:....|.:::      .||.|.:..|.::||..|||||::|.|..||.  .|..:||.:|.:..
Mouse   687 LLPDPRELIEI------KNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENP 745

  Fly   439 GLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQ 503
            .|:|..||:::.::.  |.|:|::||:...|..|.|.:|||.:|.:|||||||..|.|::|.|.:
Mouse   746 RLDKKMIGEFVSDRK--NMDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIHRLLEVFTE 808

  Fly   504 RYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDK---PTVDQFISMNRGINNGGDLPRGLL 565
            .:...|...|.|:|.|:.|::|:|||||..||.:|:.:   .|:::|....:|:|.|.|..:.:|
Mouse   809 HWRSCNGSPFANSDACFALAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDFEQDIL 873

  Fly   566 ESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLW 601
            |.:|.:|:.|...:|::....:        :|.::|
Mouse   874 EDMYHAIKNEEIVMPEEQTGLV--------RENYVW 901

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 70/184 (38%)
PH_GRP1-like 592..710 CDD:269954 2/10 (20%)
PH 596..708 CDD:278594 2/6 (33%)
Gbf1XP_006526643.1 Sec7_N 401..546 CDD:372313
COG5307 484..>1003 CDD:227623 94/361 (26%)
Sec7 700..885 CDD:366596 71/186 (38%)
PHA03247 <1730..1860 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.