DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and ARFGEF2

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_006411.2 Gene:ARFGEF2 / 10564 HGNCID:15853 Length:1785 Species:Homo sapiens


Alignment Length:257 Identity:106/257 - (41%)
Similarity:146/257 - (56%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 YINTEQSDNLVILRRPSKQIKD-------ELCEVVSEMEAL----------DVPEDCKHSNKDKQ 398
            |:|.....:|...|...::|.|       ..|.|.| ||:.          |.||..:...:.|:
Human   582 YVNPNHQTSLGQERLTDQEIGDGKGLDMARRCSVTS-MESTVSSGTQTTVQDDPEQFEVIKQQKE 645

  Fly   399 -MSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKA 462
             :..|.:.||..||:||::|.|..:|....:|:|.||::.|.|:.|.:||:||:...||::|:.|
Human   646 IIEHGIELFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYA 710

  Fly   463 FVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRY--CQLNPDIFTNTDTCYVLSFA 525
            :|...||.....|.|||.||..||||||||||||:||.||.||  |.....:|.:.||.|||:::
Human   711 YVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYS 775

  Fly   526 IIMLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDL 587
            ||||.|.||:|.||:|.|.:|:|.||||||:..|||...|.|:||.|  |..||...:..:|
Human   776 IIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEI--EGKKIAMKETKEL 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 89/182 (49%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
ARFGEF2NP_006411.2 DCB, DCB:DCB domain and DCB:HUS domain interaction 2..224
PLN03076 11..1711 CDD:215560 106/257 (41%)
DCB 28..198 CDD:292830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..285
Sec7_N 370..524 CDD:289549
HUS, DCB:HUS domain interaction 508..528
Sec7 643..827 CDD:279680 89/185 (48%)
DUF1981 1167..1248 CDD:286414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1514..1535
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.