DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment step and LOC101886286

DIOPT Version :9

Sequence 1:	NP_001036375.2	Gene:	step / 35425	FlyBaseID:	FBgn0086779	Length:	727	Species:	Drosophila melanogaster
Sequence 2:	XP_005169554.1	Gene:	LOC101886286 / 101886286	-ID:	-	Length:	297	Species:	Danio rerio

Alignment Length:	141	Identity:	30/141 - (21%)
Similarity:	45/141 - (31%)	Gaps:	46/141 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   588 MHTFFNPDKEGWLWKQG-----------------GRYKSWKRRWFILNDNCLYY--FEYTTDKE- 632
            |.:.|.|.....|:|.|                 |: :.||..:.:|....||.  .||..||:
Zfish     1 MSSGFVPASGALLYKMGFLVRKVHADCDGKRTPRGK-RGWKTFYAVLKGLILYLQKGEYRPDKQL 64

  Fly   633 -----PRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAAT 692
                 ...:....::::|......:|:.|.|..   ||                 ..||...|..
Zfish    65 SDEDLKNAVSIHHSLAIRATDYSKRPNVFYLRT---AD-----------------WRVYLFQAPN 109

  Fly   693 EEDQQEWIKRL 703
            .|..|.||.|:
Zfish   110 AEQMQSWITRI 120

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
step	NP_001036375.2	Sec7	397..577	CDD:279680
		PH_GRP1-like	592..710	CDD:269954	29/137 (21%)
		PH	596..708	CDD:278594	27/133 (20%)
LOC101886286	XP_005169554.1	PH_EFA6	11..133	CDD:270107	27/131 (21%)
LOC101886286	XP_005169554.1	PH	13..121	CDD:278594	27/129 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5307
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810