DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and dock9b

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_021332715.1 Gene:dock9b / 100151488 ZFINID:ZDB-GENE-090916-2 Length:2095 Species:Danio rerio


Alignment Length:328 Identity:70/328 - (21%)
Similarity:122/328 - (37%) Gaps:66/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 YLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQ 480
            |:.:..|...:|.:....|.:.|.|..|.:......|....|.:        |:.| :|||...|
Zfish    23 YVCKPELQAAEPDEDEDTLSRRESLAVTPLAAASAVKPKVIEPL--------DYEN-VLVQRKTQ 78

  Fly   481 FLWS-----FRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKD 540
            .|..     .:.|.:..:|..:.......|..: ||......:..::...|...|:..|..:.|.
Zfish    79 ILSDVLRDMLQFPIDDFQISTLKRQGRTLYSSV-PDGAEKRASSLLVQECIKTYNSDWHVVNYKY 142

  Fly   541 KPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQD-----DGNDLMHTFFNPDKEGWL 600
            :.....|    |.:.|  .:||.      |.:.:..|::.:|     |...|........|.|||
Zfish   143 EDYSGDF----RQLPN--KVPRP------EKLASHVFEVDEDADKEEDAASLGSQRGGVSKHGWL 195

  Fly   601 WKQGGR------YKSWKRRWFILND------NCLYYFEYTTDKEPRGIIPLENISVREIHDRSKP 653
            :|....      .||:|||:|.|..      |..:|.:....|||:|.|.|::......:.:.:.
Zfish   196 YKANMNSAISVTMKSFKRRYFHLTQLGDGSYNLNFYKDEKISKEPKGTIFLDSCMGVIQNSKVRR 260

  Fly   654 HCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHNPFYDILVQ 718
            ..|||                   .::.|.| |.::|.:|.:..:||..|.: |.|:.| ::.:|
Zfish   261 FAFEL-------------------KMQDKST-YLLAADSEGEMDDWISTLNK-ILHSSF-ELAMQ 303

  Fly   719 RKK 721
            .::
Zfish   304 ERR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 31/165 (19%)
PH_GRP1-like 592..710 CDD:269954 32/129 (25%)
PH 596..708 CDD:278594 31/123 (25%)
dock9bXP_021332715.1 DUF3398 77..168 CDD:314708 17/103 (17%)
PH_DOCK-D 184..307 CDD:270087 35/145 (24%)
C2_Dock-D 650..832 CDD:176079
DHR2_DOCK9 1634..2050 CDD:212571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.