DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and fbxo8

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001120293.1 Gene:fbxo8 / 100145349 XenbaseID:XB-GENE-964650 Length:316 Species:Xenopus tropicalis


Alignment Length:285 Identity:78/285 - (27%)
Similarity:126/285 - (44%) Gaps:47/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 NNNNDSKRESQQSNLCESCRMLLDRN------YINTEQSDNLVILRRPSKQIKDELCEVVSEMEA 383
            :|:|.:.|...|..: :.||:|..||      :||.|.....:.|...|.....:||  ::....
 Frog    34 DNDNLNYRRQLQGGM-DICRLLKVRNAKDQQGFINLEMLPPELSLTILSYLNATDLC--LASCVW 95

  Fly   384 LDVPED-------CK----------------HSNKDKQMSI--GRKKFNMDPKKGIEYLVENRLL 423
            .|:..|       ||                .|.:|..|.:  |...||.:|..||||.:...:|
 Frog    96 QDLANDEILWQGLCKSTWGHCSIYNKRHPLGFSFRDLYMRLDEGSLTFNANPHWGIEYFISRGIL 160

  Fly   424 RHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLP 488
            ....:::|.|::....||...:..||    |...|||...|.||:|:|..|..|||.|......|
 Frog   161 DDSAKEIAKFIFCTRTLNWKNLRLYL----DRRRDVLDELVTLHNFSNQFLPNALRDFFRHIHAP 221

  Fly   489 GE-AQKIDRMMETFAQRYCQLNP----DIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFI 548
            .| .:.::.::..|:.|:|..||    |:..:.|..|||.:::|:|:..|.:|.||:|.:..:||
 Frog   222 EERGEYLETLITKFSNRFCACNPALARDLGLSPDAVYVLCYSLILLSIDLASPHVKNKMSKREFI 286

  Fly   549 -SMNRGINNGGDLPRGLLESLYESI 572
             :..|...|   :....:..||::|
 Frog   287 RNTRRAAQN---ISEDFVGHLYDNI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 56/184 (30%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
fbxo8NP_001120293.1 F-box-like 71..109 CDD:372399 6/39 (15%)
Sec7 130..309 CDD:238100 57/186 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.