DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and cyth4b

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:NP_001108375.2 Gene:cyth4b / 100141338 ZFINID:ZDB-GENE-080219-45 Length:395 Species:Danio rerio


Alignment Length:396 Identity:236/396 - (59%)
Similarity:299/396 - (75%) Gaps:7/396 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 ESQQSNLCESCRMLLDRNYINTEQSDNLVILRRPSKQIKDELCEVVSEMEALDVPEDCKHSNKDK 397
            |...:.|....:|.::|..|:.:      ||....:::|.::..|:::::.....||.|...::|
Zfish     3 ECSDTELTVEEQMEIERLKIHKQ------ILLEDIEKLKSQIENVMADIQDFKSAEDNKTLEREK 61

  Fly   398 QMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKA 462
            :.|.|:|||||||||||.:||:|.||....:.||.||||.||||||||||:|||:.:.:..:|||
Zfish    62 RFSSGKKKFNMDPKKGIRFLVDNGLLDWKAERVAEFLYKEEGLNKTAIGDFLGEREEMHLQILKA 126

  Fly   463 FVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAII 527
            ||.||:|::|.||||||||||||||||||||||||||.||.|||..|..:|.:|||||:||||||
Zfish   127 FVELHEFSDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCNCNISVFQSTDTCYILSFAII 191

  Fly   528 MLNTSLHNPSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFF 592
            |||||||||:||||.|:::|||||||||||.|||..||.:||.|||.||||||:||||||.||||
Zfish   192 MLNTSLHNPNVKDKTTLERFISMNRGINNGEDLPDDLLTNLYNSIRNEPFKIPEDDGNDLTHTFF 256

  Fly   593 NPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFE 657
            |||:||||.|.|||.|:||||||||.|||||||||||||||||||||||:.|||:..:.||:|.|
Zfish   257 NPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLCVREVIFQRKPYCLE 321

  Fly   658 LF-ATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHNPFYDILVQRKK 721
            |: .......||||||:::|:||||||..|.:||:|.|::.:||:.:..||:.:||||::..|||
Zfish   322 LYNPNSRGQKIKACKTETDGRVVEGKHQSYTISASTAEERDQWIESIRASITKDPFYDLVSIRKK 386

  Fly   722 KALSKS 727
            |...|:
Zfish   387 KVTGKA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 127/179 (71%)
PH_GRP1-like 592..710 CDD:269954 74/118 (63%)
PH 596..708 CDD:278594 69/112 (62%)
cyth4bNP_001108375.2 Sec7 59..241 CDD:279680 127/181 (70%)
PH_GRP1-like 256..375 CDD:269954 74/118 (63%)
PH 260..372 CDD:278594 68/111 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 174 1.000 Domainoid score I3615
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 534 1.000 Inparanoid score I1168
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000619
OrthoInspector 1 1.000 - - otm25514
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.