DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and Adamtsl5

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:XP_011241828.1 Gene:Adamtsl5 / 66548 MGIID:1913798 Length:548 Species:Mus musculus


Alignment Length:188 Identity:65/188 - (34%)
Similarity:83/188 - (44%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GAGGGPGQWSSWSDWSTCSRTCDGGIMHQMRRC-GSPGS--CRGESTRYRICNMQPCPE-QQDFR 130
            ||..|||:|:.|..||.||.:|..|:..:.|:| ..||.  |.|:|..||:|.:..||. ...||
Mouse   104 GAAQGPGEWTPWGSWSRCSSSCGRGVSVRRRQCVRLPGEELCWGDSHEYRVCQLPDCPPGTTPFR 168

  Fly   131 SSQCSAYNDVPYDGT--LYKWTPHYDYVEPCALTC--RGHPAHLVEDISRETGDGNAEEAEHYDE 191
            ..|||.||..|...|  .|:|.|.:.....|.|.|  .||                         
Mouse   169 DLQCSLYNGHPVLDTQKTYQWVPFHGAPNVCDLNCLAEGH------------------------- 208

  Fly   192 QSVIVQLSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCGGDGNSC 249
              .......||.|||.|..|:..:|:.|:|...|||..:||....|.||:|||..:||
Mouse   209 --AFYHSFGRVLDGTPCTPGTQGLCVAGRCLSAGCDGILGSGTLEDRCGLCGGANDSC 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 18/48 (38%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
Adamtsl5XP_011241828.1 TSP1 112..161 CDD:214559 18/48 (38%)
ADAM_spacer1 270..375 CDD:368694
NTR_like 442..541 CDD:239600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.