| Sequence 1: | NP_001036374.1 | Gene: | nolo / 35424 | FlyBaseID: | FBgn0051619 | Length: | 1394 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001334976.1 | Gene: | col28a1a / 555428 | ZFINID: | ZDB-GENE-070705-84 | Length: | 1170 | Species: | Danio rerio |
| Alignment Length: | 198 | Identity: | 46/198 - (23%) |
|---|---|---|---|
| Similarity: | 71/198 - (35%) | Gaps: | 56/198 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 555 GEGIRRRTYNCKIFLEYSRTVATV-NDSLCEGKKP---HDEVERC----VEDPCMLPSHGFDDQF 611
Fly 612 P--RDSIKVGVSEPGKTYVWREQGYTSCSASCLGGVEELIINCVRE-DNGRVVS-------PFLC 666
Fly 667 SPETKPEARVRTCNDRPCPPRWNYSDYTPCSKSCGIGIKTREVQCIHEVTRGGDNTMVVPNSMCP 731
Fly 732 QPP 734 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| nolo | NP_001036374.1 | TSP1 | 78..124 | CDD:214559 | |
| TSP1 | 546..600 | CDD:214559 | 14/52 (27%) | ||
| TSP1 | 750..807 | CDD:214559 | |||
| IGc2 | 845..902 | CDD:197706 | |||
| PLAC | 1355..1384 | CDD:285849 | |||
| col28a1a | NP_001334976.1 | vWFA_subfamily_ECM | 49..214 | CDD:238727 | |
| Collagen | 266..339 | CDD:189968 | |||
| Collagen | 311..384 | CDD:189968 | |||
| Collagen | 491..548 | CDD:189968 | |||
| Collagen | 529..590 | CDD:189968 | |||
| Collagen | 561..633 | CDD:189968 | |||
| Collagen | 700..776 | CDD:189968 | |||
| VWA | 803..980 | CDD:306576 | 22/102 (22%) | ||
| Kunitz_BPTI | 1117..1168 | CDD:278443 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3538 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||